Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (c Myc, Cellular Myelocytomatosis Oncogene, Myc Protein, Myc Proto-oncogene Protein, Myc2, Niard, Nird, Transcription Factor p64, v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian) ) (Biotin) discontinued
C0035-03H-Biotin 100 µL

C-Myc (c Myc, Cellular Myelocytomatosis Oncogene, Myc Protein, Myc Proto-oncogene Protein, Myc2, Niard, Nird, Transcription Factor p64, v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian) ) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)
orb2904793-01 20 µg

Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)

Sign In for Pricing
View Details
Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)
orb2904793-02 100 µg

Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)

Sign In for Pricing
View Details
ALG2 Protein Vector (Human) (pPM-C-HA)
PV001375 500 ng

ALG2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Acetylated Lysine Antibody
MBS801115 0.025 mg

Acetylated Lysine Antibody

Sign In for Pricing
View Details
LMA1L, ID (LMAN1L, ERGL, Protein ERGIC-53-like, ERGIC53-like protein, Lectin mannose-binding 1-like) (MaxLight 490) discontinued
037827-ML490 100 µL

LMA1L, ID (LMAN1L, ERGL, Protein ERGIC-53-like, ERGIC53-like protein, Lectin mannose-binding 1-like) (MaxLight 490) discontinued

Sign In for Pricing
View Details