Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)

This Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 27, Super conserved receptor expressed in brain 1

UniProt

O54897

Expression Region

1-379

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANASEPGGGGSGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLL LDLCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVG VTRYLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQR PDGAPGALGFLLLLAAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATG QAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLL WGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCC QSPQATQATLPCDLKGIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NRG4 Antibody
NBP3-12811-100ul 100 µL

Rabbit Polyclonal NRG4 Antibody

Sign In for Pricing
View Details
Glyctk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3781507 1.0 µg DNA

Glyctk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Epidermal Growth Factor (EGF) Antibody
20212-05011 150 µg

Human Epidermal Growth Factor (EGF) Antibody

Sign In for Pricing
View Details
GABRA1 Polyclonal Antibody
RD265881A-01 60 μL

GABRA1 Polyclonal Antibody

Sign In for Pricing
View Details
GABRA1 Polyclonal Antibody
RD265881A-02 120 μL

GABRA1 Polyclonal Antibody

Sign In for Pricing
View Details
GABRA1 Polyclonal Antibody
RD265881A-03 200 µL

GABRA1 Polyclonal Antibody

Sign In for Pricing
View Details