Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)

This Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 27, Super conserved receptor expressed in brain 1

UniProt

O54897

Expression Region

1-379

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANASEPGGGGSGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLL LDLCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVG VTRYLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQR PDGAPGALGFLLLLAAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATG QAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLL WGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCC QSPQATQATLPCDLKGIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF146 Double Nickase Plasmid (h2)
sc-411095-NIC-2 20 µg

ZNF146 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Slc24a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3514907 1.0 µg DNA

Slc24a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)
MBS1234562-01 0.02 mg (E-Coli)

Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)

Sign In for Pricing
View Details
Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)
MBS1234562-02 0.1 mg (E-Coli)

Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)

Sign In for Pricing
View Details
Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)
MBS1234562-03 0.02 mg (Yeast)

Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)

Sign In for Pricing
View Details
Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)
MBS1234562-04 0.1 mg (Yeast)

Recombinant Drosophila ananassae Nuclear cap-binding protein subunit 2 (Cbp20)

Sign In for Pricing
View Details