Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-Treponema pallidum IgG (MT3)
A11A75-MT3-G 1 Each

Human anti-Treponema pallidum IgG (MT3)

Sign In for Pricing
View Details
SFN Antibody (Center) [APR13281G]
APR13281G-01 50 µL

SFN Antibody (Center) [APR13281G]

Sign In for Pricing
View Details
SFN Antibody (Center) [APR13281G]
APR13281G-02 100 µL

SFN Antibody (Center) [APR13281G]

Sign In for Pricing
View Details
SFN Antibody (Center) [APR13281G]
APR13281G-03 200 µL

SFN Antibody (Center) [APR13281G]

Sign In for Pricing
View Details
SFN Antibody (Center) [APR13281G]
APR13281G-04 400 µL

SFN Antibody (Center) [APR13281G]

Sign In for Pricing
View Details
Recombinant FAdV-1 Uncharacterized 14.4 kDa Protein (aa 1-126)
VAng-Cr4191-1mgEcoli 1 mg (E. coli)

Recombinant FAdV-1 Uncharacterized 14.4 kDa Protein (aa 1-126)

Sign In for Pricing
View Details