Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 5 (CD300LD), partial

This Recombinant Human CMRF35-like molecule 5 (CD300LD), partial spans the amino acid sequence from region 19-165aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLM-5; CD300 antigen-like family member D; CMRF35-A4; CD antigen CD300d

UniProt

Q6UXZ3

Expression Region

19-165aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EZH2 (Thr369) Antibody
AF8605-01 100 µL

Phospho-EZH2 (Thr369) Antibody

Sign In for Pricing
View Details
Phospho-EZH2 (Thr369) Antibody
AF8605-02 200 µL

Phospho-EZH2 (Thr369) Antibody

Sign In for Pricing
View Details
Antitumor agent-153
HY-163518 1 Each

Antitumor agent-153

Sign In for Pricing
View Details
SGC2085 HCl
T4013-01 1 mg

SGC2085 HCl

Sign In for Pricing
View Details
SGC2085 HCl
T4013-02 2 mg

SGC2085 HCl

Sign In for Pricing
View Details
SGC2085 HCl
T4013-03 5 mg

SGC2085 HCl

Sign In for Pricing
View Details