Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial

This Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial spans the amino acid sequence from region 19-177aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLM-5; CD300 antigen like family member D; Leukocyte mono-Ig-like receptor 4; Myeloid-associated immunoglobulin-like receptor 4; MAIR-4; MAIR-IV

UniProt

Q8VCH2

Expression Region

19-177aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDSVTGPEEVSGQEQGSLTVQCRYSSYWKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGPDPMFKVNVNIDQAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVTQSRPHTRSLLSSIY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A2 Rabbit pAb (APR24777N)
APR24777N-01 50 µL

EEF1A2 Rabbit pAb (APR24777N)

Sign In for Pricing
View Details
EEF1A2 Rabbit pAb (APR24777N)
APR24777N-02 100 µL

EEF1A2 Rabbit pAb (APR24777N)

Sign In for Pricing
View Details
EEF1A2 Rabbit pAb (APR24777N)
APR24777N-03 200 µL

EEF1A2 Rabbit pAb (APR24777N)

Sign In for Pricing
View Details
BUB3 Rabbit pAb
E45R26613N-50 50 µL

BUB3 Rabbit pAb

Sign In for Pricing
View Details
Adenosine 2',3'-cyclic Monophosphate Sodium Salt (AMP-Na)
295214-01 100 mg

Adenosine 2',3'-cyclic Monophosphate Sodium Salt (AMP-Na)

Sign In for Pricing
View Details
Adenosine 2',3'-cyclic Monophosphate Sodium Salt (AMP-Na)
295214-02 250 mg

Adenosine 2',3'-cyclic Monophosphate Sodium Salt (AMP-Na)

Sign In for Pricing
View Details