Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1A2 Rabbit pAb (APR24777N)

Product Specifications

Background

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EEF1A2 Rabbit pAb (APR24777N) .

Synonyms

EEF1A2; EEF1AL; EF-1-alpha-2; EF1A; EIEE33; HS1; MRD38; STN; STNL

Gene ID

1917

UniProt

Q05639

Cellular Locus

Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1917

Uniprot URL

https://www.uniprot.org/uniprot/Q05639

AA Sequence

NPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC3 (NM_002915) Human Over-expression Lysate
LS005983 100 µg

RFC3 (NM_002915) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial
MBS1449558-01 0.5 mg (E-Coli)

Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial

Sign In for Pricing
View Details
Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial
MBS1449558-02 0.05 mg (Baculovirus)

Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial

Sign In for Pricing
View Details
Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial
MBS1449558-03 0.5 mg (Yeast)

Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial

Sign In for Pricing
View Details
Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial
MBS1449558-04 0.05 mg (Mammalian-Cell)

Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial

Sign In for Pricing
View Details
Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial
MBS1449558-05 1 mg (E-Coli)

Recombinant Notophthalmus viridescens Fibroblast growth factor receptor 2 (FGFR2), partial

Sign In for Pricing
View Details