Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1A2 Rabbit pAb (APR24777N)

Product Specifications

Background

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EEF1A2 Rabbit pAb (APR24777N) .

Synonyms

EEF1A2; EEF1AL; EF-1-alpha-2; EF1A; EIEE33; HS1; MRD38; STN; STNL

Gene ID

1917

UniProt

Q05639

Cellular Locus

Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1917

Uniprot URL

https://www.uniprot.org/uniprot/Q05639

AA Sequence

NPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL
BNCB2166-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Monoethyl Phthalate
TRC-M542580-50MG 50 mg

Monoethyl Phthalate

Sign In for Pricing
View Details
Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Recombinant Protein
TP762535 50 µg

Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Recombinant Protein

Sign In for Pricing
View Details
PLCG 2 (PLCG2) Rabbit Monoclonal Antibody
TA423865 100 µL

PLCG 2 (PLCG2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]
TA504762AM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
MMP-9 Recombinant Rabbit Monoclonal Antibody [JA80-73]
ET1704-69 100 µL

MMP-9 Recombinant Rabbit Monoclonal Antibody [JA80-73]

Sign In for Pricing
View Details