Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Uncharacterized protein

This Recombinant Prunus persica Uncharacterized protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

M5XYM8

Expression Region

1-305aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAVTKSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQSSSSYLPTTLSSQNSASPSLSPNCSAPSISLPTSPPSKVSQIFDHPINGNSSSVTSPSIFSSDSLISQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGPNLDPASAICDFDNQQFDCQMTAGDWMLDNMTDTLWNMEGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSCB, CT (FSCB, C14orf155, Fibrous sheath CABYR-binding protein) (MaxLight 550)
MBS6300187-01 0.1 mL

FSCB, CT (FSCB, C14orf155, Fibrous sheath CABYR-binding protein) (MaxLight 550)

Sign In for Pricing
View Details
FSCB, CT (FSCB, C14orf155, Fibrous sheath CABYR-binding protein) (MaxLight 550)
MBS6300187-02 5x 0.1 mL

FSCB, CT (FSCB, C14orf155, Fibrous sheath CABYR-binding protein) (MaxLight 550)

Sign In for Pricing
View Details
AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A)
123381 100 µg

AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A)

Sign In for Pricing
View Details
Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated
orb3006205-01 20 µg

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

Sign In for Pricing
View Details
Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated
orb3006205-02 100 µg

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

Sign In for Pricing
View Details
Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated
orb3006205-03 1 mg

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

Sign In for Pricing
View Details