Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO18A Human Gene Knockout Kit (CRISPR)
KN416905 1 Kit

MYO18A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PTTG1 Antibody
RC-5087-01 50 μL

Recombinant PTTG1 Antibody

Sign In for Pricing
View Details
Recombinant PTTG1 Antibody
RC-5087-02 100 µL

Recombinant PTTG1 Antibody

Sign In for Pricing
View Details
Recombinant PTTG1 Antibody
RC-5087-03 1 mL

Recombinant PTTG1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS806290 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Over-expression Lysate
LY400705 100 µg

Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Over-expression Lysate

Sign In for Pricing
View Details