Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP1 Mouse Monoclonal Antibody [Clone ID: OTI2F4]
CF811445 100 µg

SH3BP1 Mouse Monoclonal Antibody [Clone ID: OTI2F4]

Sign In for Pricing
View Details
TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody
TA371857 100 µL

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM35A (ESRP1) (NM_001034915) Human Recombinant Protein
TP310539 20 µg

RBM35A (ESRP1) (NM_001034915) Human Recombinant Protein

Sign In for Pricing
View Details
C19orf75 (SIGLECL1) (NM_173635) Human Recombinant Protein
TP321431L 1 mg

C19orf75 (SIGLECL1) (NM_173635) Human Recombinant Protein

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF594 conjugate, 0.1mg/mL
BNC943636-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL
BNC882960-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details