Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Envelope small membrane protein (E)

This Recombinant Bat coronavirus HKU3 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q3LZW9

Expression Region

1-76

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]
AN00568D-01 20 Tests

PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]

Sign In for Pricing
View Details
PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]
AN00568D-02 100 Tests

PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]

Sign In for Pricing
View Details
PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]
AN00568D-03 2x 100 Tests

PE Anti-Human TCR Vα24-Jα18 Antibody[6B11]

Sign In for Pricing
View Details
PTPN18 (NM_001142370) Human Over-expression Lysate
LY428059 100 µg

PTPN18 (NM_001142370) Human Over-expression Lysate

Sign In for Pricing
View Details
TAK1 (Ab-184) Antibody
8B1123-AAT 50 µg

TAK1 (Ab-184) Antibody

Sign In for Pricing
View Details
Stability Test Chamber BTST-202-C
BTST-202-C 1 Unit

Stability Test Chamber BTST-202-C

Sign In for Pricing
View Details