Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein R40

UniProt

Q5UPC1

Expression Region

1-101

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNNFRDSVLAILVCQFIGPNVFIIIGSIGSVIGVKIMEMYPHYCENHGIYIDKTSVGI AHGIYGIILGFIGIYVFLFVLLFILSIIFSIIYVISKRLSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial
CSB-EP875357MO-01 20 µg

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial
CSB-EP875357MO-02 100 µg

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial
CSB-EP875357MO-03 1 mg

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Sign In for Pricing
View Details
300μl Rainin non-filtered pipette tips, bagged, low retention
RDP-300-L 1000pcs/bag, 20bags/ctn

300μl Rainin non-filtered pipette tips, bagged, low retention

Sign In for Pricing
View Details
Lentiviral human PCDHGA5 shRNA (UAS) - Lentiviral human PCDHGA5 shRNA (UAS) (25)
GTR15104189 1 Vial

Lentiviral human PCDHGA5 shRNA (UAS) - Lentiviral human PCDHGA5 shRNA (UAS) (25)

Sign In for Pricing
View Details
Ssxb6 3'UTR Lenti-reporter-Luc Vector
45588084 1.0 µg

Ssxb6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details