Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Product Specifications

Product Name Alternative

IL-36 receptor Interleukin-1 receptor-related protein 2 Short name: IL-1Rrp2 Short name: IL1R-rp2

Abbreviation

Recombinant Mouse Il1rl2 protein, partial

Gene Name

Il1rl2

UniProt

Q9ERS7

Expression Region

22-338aa

Organism

Mus musculus (Mouse)

Target Sequence

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for interleukin-36 (IL36A, IL36B and IL36G) . After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for interleukin-36 (IL36A, IL36B and IL36G) . After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.

Molecular Weight

40 kDa

References & Citations

"IL-36R ligands are potent regulators of dendritic and T cells."Vigne S., Palmer G., Lamacchia C., Martin P., Talabot-Ayer D., Rodriguez E., Ronchi F., Sallusto F., Dinh H., Sims J.E., Gabay C.Blood 118:5813-5823 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Polyclonal Antibody, PE-Cy7 Conjugated
bs-4755R-PE-Cy7 100 µL

CD19 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Ubiquitin (Ub) ELISA Kit
RD-Ub-Mu-48Tests 48 Tests

Mouse Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
1- (5-Chlorothiophen-2-yl) propan-2-one
ZZB95878-01 50 mg

1- (5-Chlorothiophen-2-yl) propan-2-one

Sign In for Pricing
View Details
1- (5-Chlorothiophen-2-yl) propan-2-one
ZZB95878-02 0.5 g

1- (5-Chlorothiophen-2-yl) propan-2-one

Sign In for Pricing
View Details
Ppih (NM_028677) Mouse Recombinant Protein
TP501558 20 µg

Ppih (NM_028677) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-Integrin alpha 2/ITGA2 Antibody Picoband®, FITC Conjugate
A01933-2-FITC 100 µg/Vial

Anti-Integrin alpha 2/ITGA2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details