Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Product Specifications

Product Name Alternative

IL-36 receptor Interleukin-1 receptor-related protein 2 Short name: IL-1Rrp2 Short name: IL1R-rp2

Abbreviation

Recombinant Mouse Il1rl2 protein, partial

Gene Name

Il1rl2

UniProt

Q9ERS7

Expression Region

22-338aa

Organism

Mus musculus (Mouse)

Target Sequence

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for interleukin-36 (IL36A, IL36B and IL36G) . After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for interleukin-36 (IL36A, IL36B and IL36G) . After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.

Molecular Weight

40 kDa

References & Citations

"IL-36R ligands are potent regulators of dendritic and T cells."Vigne S., Palmer G., Lamacchia C., Martin P., Talabot-Ayer D., Rodriguez E., Ronchi F., Sallusto F., Dinh H., Sims J.E., Gabay C.Blood 118:5813-5823 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RRAGD CRISPR All-in-one AAV vector set (with saCas9)(Human)
42735151 3x1.0μg DNA

RRAGD CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Gamma-Aminobutyric Acid Receptor subunit rho-3 (GABRR3) Human ELISA Kit
D6024 96 Tests

Gamma-Aminobutyric Acid Receptor subunit rho-3 (GABRR3) Human ELISA Kit

Ask
View Details
LHX4, ID (LHX4, LIM/homeobox protein Lhx4) (MaxLight 490)
MBS6315993-01 0.1 mL

LHX4, ID (LHX4, LIM/homeobox protein Lhx4) (MaxLight 490)

Ask
View Details
LHX4, ID (LHX4, LIM/homeobox protein Lhx4) (MaxLight 490)
MBS6315993-02 5x 0.1 mL

LHX4, ID (LHX4, LIM/homeobox protein Lhx4) (MaxLight 490)

Ask
View Details
TIM-3 Fc
S01-081-L500 500 µg

TIM-3 Fc

Ask
View Details
Olr1690 AAV siRNA Pooled Vector
34141166 1.0 μg

Olr1690 AAV siRNA Pooled Vector

Ask
View Details