Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 242 (TMEM242)

This Recombinant Human Transmembrane protein 242 (TMEM242) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Transmembrane protein 242

UniProt

Q9NWH2

Expression Region

1-141

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEW FNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSI FPTIPKNSESAVEWEETLKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renalase Antibody
46-279 0.1 mg

Renalase Antibody

Sign In for Pricing
View Details
GNF2133 hydrochloride
orb1687001-01 25 mg

GNF2133 hydrochloride

Sign In for Pricing
View Details
GNF2133 hydrochloride
orb1687001-02 50 mg

GNF2133 hydrochloride

Sign In for Pricing
View Details
GNF2133 hydrochloride
orb1687001-03 100 mg

GNF2133 hydrochloride

Sign In for Pricing
View Details
DDR2 Ascites Mouse mAb
MBS8550884-01 0.1 mL

DDR2 Ascites Mouse mAb

Sign In for Pricing
View Details
DDR2 Ascites Mouse mAb
MBS8550884-02 0.1 mL (AF405L)

DDR2 Ascites Mouse mAb

Sign In for Pricing
View Details