Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein A34 (A34R)

This Recombinant Vaccinia virus Protein A34 (A34R) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Protein A34

UniProt

P21057

Expression Region

1-168

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLNRQTVSMFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNNKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKKFYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS6ST1P1 3'UTR GFP Stable Cell Line
TU060179 1.0 mL

HS6ST1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(+) -TK216
HY-122903B-01 5 mg

(+) -TK216

Sign In for Pricing
View Details
(+) -TK216
HY-122903B-02 10 mM - 1 mL

(+) -TK216

Sign In for Pricing
View Details
(+) -TK216
HY-122903B-03 10 mg

(+) -TK216

Sign In for Pricing
View Details
(+) -TK216
HY-122903B-04 25 mg

(+) -TK216

Sign In for Pricing
View Details
(+) -TK216
HY-122903B-05 50 mg

(+) -TK216

Sign In for Pricing
View Details