Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q2FZJ9

Expression Region

20-366

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PER2 Rabbit monoclonal antibody
E43S41097 100 µL

PER2 Rabbit monoclonal antibody

Sign In for Pricing
View Details
EGFR (31G7), Biotin conjugate, 0.1mg/mL
BNCB1194-100 1x 100 µL

EGFR (31G7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBM8A Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62134R-BF750-TR 20 µL

RBM8A Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
MBTPS2 Antibody (N-term)
E45R08360G-4 50 µL

MBTPS2 Antibody (N-term)

Sign In for Pricing
View Details
Mouse Cd163 protein
orb244839-01 20 µg

Mouse Cd163 protein

Sign In for Pricing
View Details
Mouse Cd163 protein
orb244839-02 100 µg

Mouse Cd163 protein

Sign In for Pricing
View Details