Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd163 protein

This Mouse Cd163 protein spans the amino acid sequence from region 86-365aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd163

UniProt

Q2VLH6

Expression Region

86-365aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV16 E7 Polyclonal Antibody, FITC Conjugated
bs-10446R-FITC-TR 20 µL

HPV16 E7 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060762-01 0.1 mL

HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060762-02 0.2 mL

HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060762-03 0.5 mL

HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060762-04 1 mL

HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060762-05 5 mL

HRP-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details