Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd163 protein

This Mouse Cd163 protein spans the amino acid sequence from region 86-365aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd163

UniProt

Q2VLH6

Expression Region

86-365aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAA1 Rabbit pAb (APR21249N)
APR21249N-01 50 µL

ACAA1 Rabbit pAb (APR21249N)

Sign In for Pricing
View Details
ACAA1 Rabbit pAb (APR21249N)
APR21249N-02 100 µL

ACAA1 Rabbit pAb (APR21249N)

Sign In for Pricing
View Details
ACAA1 Rabbit pAb (APR21249N)
APR21249N-03 200 µL

ACAA1 Rabbit pAb (APR21249N)

Sign In for Pricing
View Details
Arhgap24 (NM_146161) Mouse Untagged Clone
MC205804 10 µg

Arhgap24 (NM_146161) Mouse Untagged Clone

Sign In for Pricing
View Details
Human Cubilin (CUBN) Elisa Kit
EK712046 96 Well

Human Cubilin (CUBN) Elisa Kit

Sign In for Pricing
View Details
Delta Sarcoglycan Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61506R-BF750-01 20 µL

Delta Sarcoglycan Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details