Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1403 (MJ1403)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1403 (MJ1403) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1403

UniProt

Q58798

Expression Region

1-374

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVSHGGILEGSSRGGKMMDWLKNKKAISPILALLIVLGVTIVVGAVFYAWGSNLFGNSQ EKTQAAVEGTATNMFYDAGAIRVAATCIDKIRYQDADDSDSWLGYPNGNGKIAKPSTSNG CYNSTYGTVFYDERFIVEIPVTIDTQDYKLTGVKVVGGIPKIVDMGGTYTNAFEDISAKF YAFWLHLNDNYQLLKKDGTLFVGYVNKSGMFEVSNGYVIAWNQTRDTYGKLASSVGATSD SSWDAVNTTTGVAPLVETSWPYYGTYCSNVKLYTATGEELKPGFGSGTLVAQWFCSSATY LDKLFNNPEYVVGTLPKNSEKTVKTYLFFNTLYLPNYKGSTNDGYVTFEVPLKVVSNEGV TKEVKVKFTVYDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADAC, Human (His-SUMO)
HY-P72067-01 20 µg

AADAC, Human (His-SUMO)

Sign In for Pricing
View Details
AADAC, Human (His-SUMO)
HY-P72067-02 50 µg

AADAC, Human (His-SUMO)

Sign In for Pricing
View Details
EGFR (Extracellular) Rabbit Polyclonal Antibody
orb1294279-01 25 µL

EGFR (Extracellular) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFR (Extracellular) Rabbit Polyclonal Antibody
orb1294279-02 100 µL

EGFR (Extracellular) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)
orb2658242-01 20 µg

Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)

Sign In for Pricing
View Details
Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)
orb2658242-02 100 µg

Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)

Sign In for Pricing
View Details