Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADAC, Human (His-SUMO)

Product Specifications

UNSPSC Description

AADAC, Human (His-SUMO) is an esterase functioning at the endoplasmic reticulum which involved in the hydrolysis of various drugs. AADAC, Human overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aadac-protein-human-his-sumo.html

Purity

90.0

Smiles

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Molecular Weight

Approximately 63.1 kDa

References & Citations

[1]Yoshida T, et, al. Difference in substrate specificity of carboxylesterase and arylacetamide deacetylase between dogs and humans. Eur J Pharm Sci. 2018 Jan 1;111:167-176.|[2]Misra A, et, al. Translational Research in Culture: AADAC, Diabetes, and Cardiovascular Disease. Cell Stem Cell. 2020 Jul 2;27(1):6-7.

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aminopeptidase PILS Affinity Purified Polyclonal Ab
AF2334-SP 25 µg

Human Aminopeptidase PILS Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rpsD Protein (aa 1-206)
VAng-0144Lsx-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei rpsD Protein (aa 1-206)

Sign In for Pricing
View Details
Human POC1A knockdown cell line
ABC-KD11846 1 Vial

Human POC1A knockdown cell line

Sign In for Pricing
View Details
Sdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43233114 3x 1.0 µg

Sdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lipid Peroxide (LPO) Assay Kit (BODIPY 581/591 C11)
G1733-50UL 50 μL

Lipid Peroxide (LPO) Assay Kit (BODIPY 581/591 C11)

Sign In for Pricing
View Details
Apolipoprotein A-I (Apo A-I) (MaxLight 650)
MBS6264722-01 0.1 mL

Apolipoprotein A-I (Apo A-I) (MaxLight 650)

Sign In for Pricing
View Details