Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADAC, Human (His-SUMO)

Product Specifications

UNSPSC Description

AADAC, Human (His-SUMO) is an esterase functioning at the endoplasmic reticulum which involved in the hydrolysis of various drugs. AADAC, Human overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aadac-protein-human-his-sumo.html

Purity

90.0

Smiles

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Molecular Weight

Approximately 63.1 kDa

References & Citations

[1]Yoshida T, et, al. Difference in substrate specificity of carboxylesterase and arylacetamide deacetylase between dogs and humans. Eur J Pharm Sci. 2018 Jan 1;111:167-176.|[2]Misra A, et, al. Translational Research in Culture: AADAC, Diabetes, and Cardiovascular Disease. Cell Stem Cell. 2020 Jul 2;27(1):6-7.

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody
abx137638-01 5 µg

Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody

Sign In for Pricing
View Details
Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody
abx137638-02 20 µg

Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody

Sign In for Pricing
View Details
Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody
abx137638-03 100 µg

Low Density Lipoprotein Receptor Related Protein Associated Protein 1 (LRPAP1) Antibody

Sign In for Pricing
View Details
DACT3 Antibody
MBS9631065-01 0.1 mL

DACT3 Antibody

Sign In for Pricing
View Details
DACT3 Antibody
MBS9631065-02 0.2 mL

DACT3 Antibody

Sign In for Pricing
View Details
DACT3 Antibody
MBS9631065-03 5x 0.2 mL

DACT3 Antibody

Sign In for Pricing
View Details