Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quaternary ammonium compound-resistance protein qacE (qacE)

This Recombinant Quaternary ammonium compound-resistance protein qacE (qacE) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Quaternary ammonium compound-resistance protein qacE, Quaternary ammonium determinant E

UniProt

P0AGC9

Expression Region

1-110

Origin

Escherichia coli

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLLSKASAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Mouse Monoclonal Antibody [A8E12]
HA601073 100 µL

EGFR Mouse Monoclonal Antibody [A8E12]

Sign In for Pricing
View Details
Recombinant Mouse IL-10
6503 5 µg

Recombinant Mouse IL-10

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (DO-1), CF568 conjugate, 0.1mg/mL
BNC681658-500 1x 500 µL

P53 Tumor Suppressor Protein (DO-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Chloro-7-deazapurine
TRC-C365175-5G 5 g

6-Chloro-7-deazapurine

Sign In for Pricing
View Details
BMP 7 Human, Plant
OM296898-01 10 µg

BMP 7 Human, Plant

Sign In for Pricing
View Details
BMP 7 Human, Plant
OM296898-02 2 µg

BMP 7 Human, Plant

Sign In for Pricing
View Details