Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Product Specifications

Synonyms

Mouse ;IL-10

Label

ICT

Type

Recombinant Protein

Source

Yeast

Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Assay Protocol

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Form

Lyophilized

Shipping Conditions

Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping

Storage Temperature

-20°C

Notes

20% discount

Calculated Molecular Weight

18.8 kDa

Target Description

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms., , IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STING/TMEM173 Protein (Sumo & His Tag)
PKSH033517-01 10 µg

Recombinant Human STING/TMEM173 Protein (Sumo & His Tag)

Sign In for Pricing
View Details
Recombinant Human STING/TMEM173 Protein (Sumo & His Tag)
PKSH033517-02 50 µg

Recombinant Human STING/TMEM173 Protein (Sumo & His Tag)

Sign In for Pricing
View Details
Recombinant Human CYB5R1 Protein (His Tag)
PKSH030688 100 µg

Recombinant Human CYB5R1 Protein (His Tag)

Sign In for Pricing
View Details
FCHSD2 (NM_014824) Human Recombinant Protein
TP321241L 1 mg

FCHSD2 (NM_014824) Human Recombinant Protein

Sign In for Pricing
View Details
SERBP1 (NM_001018068) Human Over-expression Lysate
LC422719 20 µg

SERBP1 (NM_001018068) Human Over-expression Lysate

Sign In for Pricing
View Details
C6orf15 Human Gene Knockout Kit (CRISPR)
KN417689 1 Kit

C6orf15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details