BMP 7 Human, Plant
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
Product Specifications
Swiss Prot
P18075
Source
Nicotiana benthamiana.
Buffer
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Storage Conditions
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
L1565-08B-HRP 100 µL
LCK (Tyrosine-protein Kinase Lck, Leukocyte C-terminal Src Kinase, LSK, Lymphocyte Cell-specific Protein-tyrosine Kinase, Protein YT16, Proto-oncogene Lck, T Cell-specific Protein-tyrosine Kinase, p56-LCK) (HRP)
Ask
View Details 
