Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Protease HtpX (htpX)

This Recombinant Sodalis glossinidius Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q2NTD3

Expression Region

1-293

Origin

Sodalis glossinidius (strain morsitans)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRISLFLLTNLAVMVVFGIVLSLTGIQSSSAAGLMIMAGLFGFGGAFVSLLMSKSMALR SVGGEVIEQPRNETERWLLNTVRQQAQQANITMPQVALYHAPDINAFATGARRDASLVAV STGLLQNMNRDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMSS GRDEGESGNGNPLVYFAVSMVLELVFGVLASIITLWFSRHREFHADAGSARLVGREKMIA ALQRLKTSYEPQEASSMMAFCINGRNKTFSELFMSHPPLDKRIEALRSGAYLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB39A Antibody
orb680685 100 µL

RAB39A Antibody

Sign In for Pricing
View Details
Mouse Activated Protein C (APC) ELISA kit
201-02-0792 96 Tests

Mouse Activated Protein C (APC) ELISA kit

Sign In for Pricing
View Details
ZNF607 Antibody - N-terminal region
ARP36079_P050-25UL 25 µL

ZNF607 Antibody - N-terminal region

Sign In for Pricing
View Details
KU-55933
C07509-10mg 10 mg

KU-55933

Sign In for Pricing
View Details
Rabbit Monoclonal alpha-Synuclein Antibody (017) [Alexa Fluor 488]
NBP2-90051AF488 0.1 mL

Rabbit Monoclonal alpha-Synuclein Antibody (017) [Alexa Fluor 488]

Sign In for Pricing
View Details
ZMIZ1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2678803 1.0 µg DNA

ZMIZ1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details