Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 43 (TMEM43)

This Recombinant Human Transmembrane protein 43 (TMEM43) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Transmembrane protein 43, Protein LUMA

UniProt

Q9BTV4

Expression Region

2-400

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKTA TSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMAT APFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRV SFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHREL RSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta 3 Adrenergic Receptor (ADRB3) (NM_000025) Human Over-expression Lysate
LY424969 100 µg

beta 3 Adrenergic Receptor (ADRB3) (NM_000025) Human Over-expression Lysate

Sign In for Pricing
View Details
AMIGO1 (NM_020703) Human Over-expression Lysate
LC402810 20 µg

AMIGO1 (NM_020703) Human Over-expression Lysate

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Green, FITC)
E-CK-A420-01 20 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Green, FITC)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Green, FITC)
E-CK-A420-02 100 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Green, FITC)

Sign In for Pricing
View Details
Human NOB1 activation kit by CRISPRa
GA109192 1 Kit

Human NOB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Okadaic acid
SIH-521-20UG 20 µg

Okadaic acid

Sign In for Pricing
View Details