Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Synechocystis sp. Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

P74475

Expression Region

1-342

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAVDPNLFPLIAVIILGGSALLDFLLGDPKSWRHPVEFIGSVINFASQLIIRKVNDKNS RRLWGIFLGLKIIISSGFLAWLIVYLAEKVSPVLAVIIQIIGVASCFAGHSLAQAAQSVI EPLKAGDLPTARQKLALFVGRDTNNLSEREILRATVESVAENTVDGVTSPLFYALLGILF PFVGPWPLAIAYKAASTLDSMVGYKREPYTDLGWFSARLEDYLTWLPCRLTVFMLAILSG KPKQTWAIVRRDGPLDPSPNSGWSEAIYAAILGIQLGGDNYYQGVLKSKPLLGDGIQPLT IAKIAQSLWYSRTVFLWQLLLGLTVILAIQAGAMSEISFNKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-
LA-8003-1 1 mg

Alkaline Phosphatase Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-

Sign In for Pricing
View Details
CDH20 (NM_031891) Human Over-expression Lysate
LY403126 100 µg

CDH20 (NM_031891) Human Over-expression Lysate

Sign In for Pricing
View Details
MAX (NM_145113) Human Recombinant Protein
TP320343M 100 µg

MAX (NM_145113) Human Recombinant Protein

Sign In for Pricing
View Details
Catenin beta Polyclonal Antibody
E-AB-70005-01 60 µL

Catenin beta Polyclonal Antibody

Sign In for Pricing
View Details
Catenin beta Polyclonal Antibody
E-AB-70005-02 120 µL

Catenin beta Polyclonal Antibody

Sign In for Pricing
View Details
Catenin beta Polyclonal Antibody
E-AB-70005-03 200 µL

Catenin beta Polyclonal Antibody

Sign In for Pricing
View Details