Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 1D5 (OR1D5)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 1D5 (OR1D5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D5

UniProt

Q9TU90

Expression Region

1-312

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAECLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTLLMNRVTFCGPREIHYLFCE MYVLLRLACSNTHIIHTVLVATGCFIFLTPLGFMTTSYVHIVRTILQIPSASKKYKTFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGVL GRVLGRPFQRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Autophagy Related Protein 7 (ATG7) ELISA Kit
RDR-ATG7-Hu-01 96 Tests

Human Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
Human Autophagy Related Protein 7 (ATG7) ELISA Kit
RDR-ATG7-Hu-02 48 Tests

Human Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse IFNAR1 Protein (His Tag)
PDEM100218-01 20 µg

Recombinant Mouse IFNAR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNAR1 Protein (His Tag)
PDEM100218-02 100 µg

Recombinant Mouse IFNAR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNAR1 Protein (His Tag)
PDEM100218-03 500 µg

Recombinant Mouse IFNAR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNAR1 Protein (His Tag)
PDEM100218-04 1 mg

Recombinant Mouse IFNAR1 Protein (His Tag)

Sign In for Pricing
View Details