Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8B3 (OR8B3)

This Recombinant Human Olfactory receptor 8B3 (OR8B3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 8B3, Olfactory receptor OR11-311

UniProt

Q8NGG8

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLARNNSLVTEFILAGLTDHPEFQQPLFFLFLVVYIVTMVGNLGLIILFGLNSHLHTPMY YFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISYVGCMTQLFFFLFFVISECYMLTSMAY DRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCD ILPLLQLSCTSTYVNEVVVLIVVGINIMVPSCTILISYVFIVTSILHIKSTQGRSKAFST CSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVAL RKALIKIQRRNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS3), Biotin conjugate, 0.1mg/mL
BNCB1743-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ETFA (NM_000126) Human Over-expression Lysate
LC424904 20 µg

ETFA (NM_000126) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD300a/LMIR1 Protein (His Tag)
PKSH032699-01 10 µg

Recombinant Human CD300a/LMIR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD300a/LMIR1 Protein (His Tag)
PKSH032699-02 50 µg

Recombinant Human CD300a/LMIR1 Protein (His Tag)

Sign In for Pricing
View Details
FKBPL Human Gene Knockout Kit (CRISPR)
KN402153 1 Kit

FKBPL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF740 conjugate, 0.1mg/mL
BNC741130-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details