Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4A16 (OR4A16)

This Recombinant Human Olfactory receptor 4A16 (OR4A16) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Olfactory receptor 4A16, Olfactory receptor OR11-117

UniProt

Q8NH70

Expression Region

1-328

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFF LAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDR YVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMY PLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCIS HIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLMLNPLIYSLRQSEMKNAMKNLW CEKLSIVRKRVSPTLNIFIPSSKATNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bavdegalutamide (ARV-110)
S6965-25mg 25 mg

Bavdegalutamide (ARV-110)

Sign In for Pricing
View Details
Rat Rbpj Pre-designed siRNA Set A
SI211730A 1 Each

Rat Rbpj Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-IL6R Antibody Picoband® (FITC Conjugate)
A01425-1-FITC 100 µg/Vial

Anti-IL6R Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
S100A12, Human
HY-P71270-01 10 µg

S100A12, Human

Sign In for Pricing
View Details
S100A12, Human
HY-P71270-02 50 µg

S100A12, Human

Sign In for Pricing
View Details
MBP (83-99)
T81840-01 5 mg

MBP (83-99)

Sign In for Pricing
View Details