Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A12, Human

The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a12-protein-human.html

Purity

97.00

Smiles

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Molecular Formula

6283 (Gene_ID) P80511 (M1-E92) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gliocidin
E5804-25mg 25 mg

Gliocidin

Sign In for Pricing
View Details
Mouse Arsa activation kit by CRISPRa
GA200294 1 Kit

Mouse Arsa activation kit by CRISPRa

Sign In for Pricing
View Details
Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit
MBS9941153-01 48 Well

Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit
MBS9941153-02 96 Well

Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit
MBS9941153-03 5x 96 Well

Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit
MBS9941153-04 10x 96 Well

Sheep Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 1 (HCN1) ELISA Kit

Sign In for Pricing
View Details