Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A12, Human

The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a12-protein-human.html

Purity

97.00

Smiles

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Molecular Formula

6283 (Gene_ID) P80511 (M1-E92) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn1r21 shRNA (UAS) - Lentiviral mouse Vmn1r21 shRNA (UAS) (100)
GTR15121578 1 Vial

Lentiviral mouse Vmn1r21 shRNA (UAS) - Lentiviral mouse Vmn1r21 shRNA (UAS) (100)

Sign In for Pricing
View Details
KCNE3 Rabbit Polyclonal Antibody (PerCP)
orb2542101 100 µL

KCNE3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Phospho-mouse BAD (S96) Antibody
E45R05325G-4 50 µL

Phospho-mouse BAD (S96) Antibody

Sign In for Pricing
View Details
Anti-Mouse CD8 (116-13.1) In Vivo Antibody - Low Endotoxin
ICH1249-1mg 1 mg

Anti-Mouse CD8 (116-13.1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike Neutralizing Mouse mAb, AP conjugated
orb2838578 100 µL

SARS-CoV-2 (2019-nCoV) Spike Neutralizing Mouse mAb, AP conjugated

Sign In for Pricing
View Details
Recombinant Desulfotomaculum reducens Glutamyl-tRNA reductase (hemA)
MBS1083184-01 0.02 mg (E-Coli)

Recombinant Desulfotomaculum reducens Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details