Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, mouse, rat

GIP, mouse, rat

Product Specifications

Purity

≥95%

Molecular Weight

5002.69

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-hMCH (6-16) -NH2

HY-P3155-01 1 mg

Ac-hMCH (6-16) -NH2

Sign In for Pricing

Ac-hMCH (6-16) -NH2

HY-P3155-02 5 mg

Ac-hMCH (6-16) -NH2

Sign In for Pricing

DDT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

TA505604BM 100 µL

DDT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing

GPR84 antagonist 2

T72536-01 25 mg

GPR84 antagonist 2

Sign In for Pricing

GPR84 antagonist 2

T72536-02 50 mg

GPR84 antagonist 2

Sign In for Pricing

GPR84 antagonist 2

T72536-03 100 mg

GPR84 antagonist 2

Sign In for Pricing