Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Pyr3) -Amyloid β-Protein (3-42) (TFA)

(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Product Specifications

Field of Research

Neuroscience; Immunology & Inflammation

Purity

≥95%

Molecular Weight

4309.86

Notes

For research use only.

AA Sequence

{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Native Human Complement Component C3C Protein
CTP-052 100 µg

Native Human Complement Component C3C Protein

Sign In for Pricing
View Details
ATG3 polyclonal antibody
BS7872-01 50 µL

ATG3 polyclonal antibody

Sign In for Pricing
View Details
ATG3 polyclonal antibody
BS7872-02 100 µL

ATG3 polyclonal antibody

Sign In for Pricing
View Details
Rabbi! anti-Cul3 Antibody, Affinity Purified
A301-110A 100 µg

Rabbi! anti-Cul3 Antibody, Affinity Purified

Sign In for Pricing
View Details
TMEM119 AAV Vector (Rat) (CMV)
46874106 1 µg

TMEM119 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Capsid Antibody
orb810755 2 mg

Capsid Antibody

Sign In for Pricing
View Details