Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Caveolin-3 (CAV3)

This Recombinant Pig Caveolin-3 (CAV3) spans the amino acid sequence from region 1-151aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3ZDQ5

Expression Region

1-151aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMAEERTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPVFAALGQVCSNIKVMLRKEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 750)
MBS6295455-01 0.1 mL

EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 750)

Sign In for Pricing
View Details
EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 750)
MBS6295455-02 5x 0.1 mL

EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 750)

Sign In for Pricing
View Details
RASGRP2 Rabbit Polyclonal Antibody (Carrier-free)
orb3128168 100 µg

RASGRP2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
BMY-25368 (hydrochloride)
HY-19010A-01 5 mg

BMY-25368 (hydrochloride)

Sign In for Pricing
View Details
BMY-25368 (hydrochloride)
HY-19010A-02 10 mg

BMY-25368 (hydrochloride)

Sign In for Pricing
View Details
Lentiviral mouse Hsph1 shRNA (UAS) - Lentiviral mouse Hsph1 shRNA (UAS, iRFP) (25)
GTR15231194 1 Vial

Lentiviral mouse Hsph1 shRNA (UAS) - Lentiviral mouse Hsph1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details