Ebf4 Peptide - middle region

Product Specifications

Product Name Alternative

Ebf3, O/E-4, Olf-1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ebf4 Rabbit Polyclonal Antibody (orb576327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

NCBI Accession Number

NP_694538

Preservative

Lyophilized powder

AA Sequence

ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL