Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGED2 Peptide - N-terminal region

MAGED2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386

UniProt

Q9UNF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGED2 Rabbit Polyclonal Antibody (orb584497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_803182

Preservative

Lyophilized powder

AA Sequence

TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C8orf72 (FAM110B) activation kit by CRISPRa
GA114010 1 Kit

Human C8orf72 (FAM110B) activation kit by CRISPRa

Sign In for Pricing
View Details
EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]
HA722206 100 µL

EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]

Sign In for Pricing
View Details
Purified Anti-Human CD80 Antibody[2F4]
AN003450P-01 25 µg

Purified Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
Purified Anti-Human CD80 Antibody[2F4]
AN003450P-02 100 µg

Purified Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
1-(Allyloxy)-2-propanol
TRC-P565255-50MG 50 mg

1-(Allyloxy)-2-propanol

Sign In for Pricing
View Details
TST (NM_003312) Human Over-expression Lysate
LY418774 100 µg

TST (NM_003312) Human Over-expression Lysate

Sign In for Pricing
View Details