Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF4 Peptide - C-terminal region

NCF4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC3810, NCF, P40PHOX, SH3PXD4

UniProt

A8K4F9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCF4 Rabbit Polyclonal Antibody (orb584165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038202

Preservative

Lyophilized powder

AA Sequence

PSLRPLPLTSPSHGSLSHSKAPSGSQMSHNAVTSHQRPGWPGQPHSPFPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Annexin A8/ANXA8 Protein (His Tag)
PKSH030551 100 µg

Recombinant Human Annexin A8/ANXA8 Protein (His Tag)

Sign In for Pricing
View Details
Bodipy C12-Ceramide
TRC-B674600-1MG 1 mg

Bodipy C12-Ceramide

Sign In for Pricing
View Details
POTEJ Human Gene Knockout Kit (CRISPR)
KN435135 1 Kit

POTEJ Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS630849 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant Human PITPNA Protein (His Tag)
PKSH032889-01 10 µg

Recombinant Human PITPNA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PITPNA Protein (His Tag)
PKSH032889-02 50 µg

Recombinant Human PITPNA Protein (His Tag)

Sign In for Pricing
View Details