Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGDR Peptide - C-terminal region

PTGDR Peptide - C-terminal region

Product Specifications

Product Name Alternative

AS1, ASRT1, DP, DP1, MGC49004, PTGDR1

UniProt

Q13258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGDR Rabbit Polyclonal Antibody (orb584973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000944

Preservative

Lyophilized powder

AA Sequence

FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Joint
CS805803 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Recombinant Hexokinase II Monoclonal Antibody
E-AB-81474-01 50 µL

Recombinant Hexokinase II Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Hexokinase II Monoclonal Antibody
E-AB-81474-02 100 µL

Recombinant Hexokinase II Monoclonal Antibody

Sign In for Pricing
View Details
CD11c (HC1/1), 0.2mg/mL
BNUB0152-100 1x 100 µL

CD11c (HC1/1), 0.2mg/mL

Sign In for Pricing
View Details
ARPC5 / p16 ARC Antibody (Center Region)
F53994- 0.05ML 0.05 mL

ARPC5 / p16 ARC Antibody (Center Region)

Sign In for Pricing
View Details
Cytokeratin 4+5+6+8+10+13+18 Mouse Monoclonal Antibody [Clone ID: SPM583]
AM50198PU-S 100 µg

Cytokeratin 4+5+6+8+10+13+18 Mouse Monoclonal Antibody [Clone ID: SPM583]

Sign In for Pricing
View Details