Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL7 Peptide - N-terminal region

RPL7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117326, humL7-1, L7

UniProt

P18124

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL7 Rabbit Polyclonal Antibody (orb585071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000962

Preservative

Lyophilized powder

AA Sequence

KKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FLT3LG Protein (His Tag)
PDMM100222-01 20 µg

Recombinant Mouse FLT3LG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FLT3LG Protein (His Tag)
PDMM100222-02 100 µg

Recombinant Mouse FLT3LG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FLT3LG Protein (His Tag)
PDMM100222-03 500 µg

Recombinant Mouse FLT3LG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FLT3LG Protein (His Tag)
PDMM100222-04 1 mg

Recombinant Mouse FLT3LG Protein (His Tag)

Sign In for Pricing
View Details
LYPD8 Human Gene Knockout Kit (CRISPR)
KN424218 1 Kit

LYPD8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (rPTPRC/1132), CF647 conjugate, 0.1mg/mL
BNC473461-100 1x 100 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details