Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc22a3 Peptide - middle region

Slc22a3 Peptide - middle region

Product Specifications

Product Name Alternative

EMT, Oct3, Orct3, Slca22a3

UniProt

Q9WTW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc22a3 Rabbit Polyclonal Antibody (orb579026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035525

Preservative

Lyophilized powder

AA Sequence

TSSELSCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEDF/Serpin F1, Human
HY-P7054-01 10 µg

PEDF/Serpin F1, Human

Sign In for Pricing
View Details
PEDF/Serpin F1, Human
HY-P7054-02 50 µg

PEDF/Serpin F1, Human

Sign In for Pricing
View Details
Cyclin H Antibody
B0881-01 50 μL

Cyclin H Antibody

Sign In for Pricing
View Details
Cyclin H Antibody
B0881-02 100 µL

Cyclin H Antibody

Sign In for Pricing
View Details
Elk1 (Ab-389) Antibody
21037-01 50 µL

Elk1 (Ab-389) Antibody

Sign In for Pricing
View Details
Elk1 (Ab-389) Antibody
21037-02 100 µL

Elk1 (Ab-389) Antibody

Sign In for Pricing
View Details