PEDF/Serpin F1, Human
PEDF/Serpin F1 Protein, Human is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.
Product Specifications
Product Name Alternative
PEDF/Serpin F1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pedf-protein-human.html
Purity
97.00
Smiles
QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Molecular Formula
5176 (Gene_ID) P36955 (Q20-P418) (Accession)
Molecular Weight
40-49 kDa
References & Citations
[1]Steele FR, et al. Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family. Proc Natl Acad Sci U S A. 1993 Feb 15;90 (4) :1526-30.|[2]Belkacemi L, et al. Anti-tumor effects of pigment epithelium-derived factor (PEDF) : implication for cancer therapy. A mini-review. J Exp Clin Cancer Res. 2016 Jan 8;35:4.|[3]Yamagishi S, et al. Pigment epithelium-derived factor (PEDF) : its potential therapeutic implication in diabetic vascular complications. Curr Drug Targets. 2008 Nov;9 (11) :1025-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog