Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEDF/Serpin F1, Human

PEDF/Serpin F1 Protein, Human is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.

Product Specifications

Product Name Alternative

PEDF/Serpin F1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pedf-protein-human.html

Purity

97.00

Smiles

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Molecular Formula

5176 (Gene_ID) P36955 (Q20-P418) (Accession)

Molecular Weight

40-49 kDa

References & Citations

[1]Steele FR, et al. Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family. Proc Natl Acad Sci U S A. 1993 Feb 15;90 (4) :1526-30.|[2]Belkacemi L, et al. Anti-tumor effects of pigment epithelium-derived factor (PEDF) : implication for cancer therapy. A mini-review. J Exp Clin Cancer Res. 2016 Jan 8;35:4.|[3]Yamagishi S, et al. Pigment epithelium-derived factor (PEDF) : its potential therapeutic implication in diabetic vascular complications. Curr Drug Targets. 2008 Nov;9 (11) :1025-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNLIP Antibody, FITC conjugated
A31504-50UG 50 µg

PNLIP Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC15A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV693135 1.0 µg DNA

SLC15A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Camp sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4351703 1.0 µg DNA

Camp sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CD1C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E10]
TA505400BM 100 µL

CD1C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E10]

Sign In for Pricing
View Details
Avian Influenza Nonstructural Protein 1 Peptide
MBS152262-01 0.05 mg

Avian Influenza Nonstructural Protein 1 Peptide

Sign In for Pricing
View Details
Avian Influenza Nonstructural Protein 1 Peptide
MBS152262-02 5x 0.05 mg

Avian Influenza Nonstructural Protein 1 Peptide

Sign In for Pricing
View Details