Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG6 Peptide - middle region

SPAG6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434I153, MGC26276, Repro-SA-1, pf16

UniProt

O75602

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG6 Rabbit Polyclonal Antibody (orb582253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758442

Preservative

Lyophilized powder

AA Sequence

LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP L (HNRNPL) (NM_001005335) Human Over-expression Lysate
LC423861 20 µg

hnRNP L (HNRNPL) (NM_001005335) Human Over-expression Lysate

Sign In for Pricing
View Details
Med18 (NM_026039) Mouse Tagged ORF Clone
MG202211 10 µg

Med18 (NM_026039) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FAS/CD95 Polyclonal Antibody
AN006830L-01 25 µL

FAS/CD95 Polyclonal Antibody

Sign In for Pricing
View Details
FAS/CD95 Polyclonal Antibody
AN006830L-02 100 µL

FAS/CD95 Polyclonal Antibody

Sign In for Pricing
View Details
PIP5KI gamma (PIP5K1C) (NM_012398) Human Recombinant Protein
TP315828 20 µg

PIP5KI gamma (PIP5K1C) (NM_012398) Human Recombinant Protein

Sign In for Pricing
View Details
MAGEA8 (NM_001166400) Human Over-expression Lysate
LY432878 100 µg

MAGEA8 (NM_001166400) Human Over-expression Lysate

Sign In for Pricing
View Details