Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD2 Peptide - C-terminal region

FSD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-127F21, SPRYD1

UniProt

A1L4K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSD2 Rabbit Polyclonal Antibody (orb586545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007123

Preservative

Lyophilized powder

AA Sequence

DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lfng ELISA Kit
EF018910 96 Tests

Rat Lfng ELISA Kit

Sign In for Pricing
View Details
Renca-IL2
ABC-TC0960 1 Vial

Renca-IL2

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Alanine--tRNA ligase (alaS), partial
MBS1325638 Inquire

Recombinant Gluconobacter oxydans Alanine--tRNA ligase (alaS), partial

Sign In for Pricing
View Details
Mamdc4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
27975114 3x 1.0 µg

Mamdc4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)
orb2919244-01 20 µg

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)
orb2919244-02 100 µg

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

Sign In for Pricing
View Details