Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH4A Peptide - N-terminal region

RSPH4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CILD11, RSHL3, RSPH6B, dJ412I7.1

UniProt

Q5TD94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH4A Rabbit Polyclonal Antibody (orb326682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010892

Preservative

Lyophilized powder

AA Sequence

APPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPHHTSQSEGNTFQQSQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS620376 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Lentiviral human RASSF5 sgRNA gene knockout kit - Lentiviral human RASSF5 sgRNA gene knockout kit (25)
GTR15369189 1 Vial

Lentiviral human RASSF5 sgRNA gene knockout kit - Lentiviral human RASSF5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)
orb2916948-01 20 µg

Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)
orb2916948-02 100 µg

Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Ntn5 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6153803 1.0 µg DNA

Ntn5 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse Tcp11l1 Pre-designed siRNA Set B
SI114392B 1 Each

Mouse Tcp11l1 Pre-designed siRNA Set B

Sign In for Pricing
View Details