Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)

This Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8DLP8

Expression Region

1-252

Origin

Thermosynechococcus elongatus (strain BP-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPLIDLWTALPLAKLEVGHHFYWYIGNLRVHGQVFITTWFVMALLIAVAFVASRNIQRV PSGIQNLMEYALEFIRDLTKSQMGEHEYRAWVPFVGTLFLFIFVCNWSGALVPWKLIELP EGELAAPTNDINTTVALALLVSLAYFYAGLRKRGLKYFTKYIEPTPVLLPIAILEDFTKP LSLSFRLFGNILADELVVSVLVLLVPLFVPLPVMVLGLFTSAIQALVFATLAATYIGEAM EGHGGDHEAAHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-C-REL (Ser503) Rabbit Polyclonal Antibody (AP)
orb921482 100 µL

Phospho-C-REL (Ser503) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
APOE Protein Vector (Human) (pPB-C-His)
PV002125 500 ng

APOE Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Pantothenate synthetase (panC)
MBS1212355-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Pantothenate synthetase (panC)
MBS1212355-02 0.02 mg (Yeast)

Recombinant Yersinia pestis Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Pantothenate synthetase (panC)
MBS1212355-03 0.1 mg (E-Coli)

Recombinant Yersinia pestis Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Pantothenate synthetase (panC)
MBS1212355-04 0.1 mg (Yeast)

Recombinant Yersinia pestis Pantothenate synthetase (panC)

Sign In for Pricing
View Details