Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB)

This Recombinant Thermosynechococcus elongatus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8DLP8

Expression Region

1-252

Origin

Thermosynechococcus elongatus (strain BP-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPLIDLWTALPLAKLEVGHHFYWYIGNLRVHGQVFITTWFVMALLIAVAFVASRNIQRV PSGIQNLMEYALEFIRDLTKSQMGEHEYRAWVPFVGTLFLFIFVCNWSGALVPWKLIELP EGELAAPTNDINTTVALALLVSLAYFYAGLRKRGLKYFTKYIEPTPVLLPIAILEDFTKP LSLSFRLFGNILADELVVSVLVLLVPLFVPLPVMVLGLFTSAIQALVFATLAATYIGEAM EGHGGDHEAAHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dzip1l (NM_028258) Mouse Tagged ORF Clone
MR224313 10 µg

Dzip1l (NM_028258) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal RBM15B Antibody
NBP2-58773-25ul 25 µL

Rabbit Polyclonal RBM15B Antibody

Sign In for Pricing
View Details
ATP12A Polyclonal Antibody, Biotin Conjugated
A62137-050 50 µL

ATP12A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Scavenging Receptor SR-BI Rabbit pAb
APA4165-01 30 µL

Scavenging Receptor SR-BI Rabbit pAb

Sign In for Pricing
View Details
Scavenging Receptor SR-BI Rabbit pAb
APA4165-02 50 μL

Scavenging Receptor SR-BI Rabbit pAb

Sign In for Pricing
View Details
Scavenging Receptor SR-BI Rabbit pAb
APA4165-03 100 µL

Scavenging Receptor SR-BI Rabbit pAb

Sign In for Pricing
View Details